![]() Being able to send them in the direction of this app when they want to view some rushes on their own system, without waiting for you to transcode them to some more accessible format, will obviously save you a lot of time and effort. Overall HD-VU2 is very easy to use and would be intuitive enough to navigate for even the least tech savvy producer or client. HD-VU2 gives you the ability preview over 20 different camera formats, including those that won’t play in your common media players like VLC or QuickTime player, such as: There’s obviously been a lot of thought put into the functionality of the player, especially with regards to sorting and organising media, which you can see in more detail in the tutorial above and demo below. You can also temporarily add LUTS in the viewer, not affecting the source media in anyway, to see what that might look like in post, which is a nice feature. HD-VU2 is a multi format media player for Mac created by Imagine Products, the capable team behind ShotPut Pro and other post production tools, to allow you to quickly view all kinds of native camera media, along with their associated metadata, in one simple to use player. ![]() PluralEyes 4 costs $299 and the full Shooter Suite costs $399. So to sum up PluralEyes 4 is a really great update to the fastest and most accurate synching software I’ve used, and well worth adding to your editor’s toolkit. You can even hit ‘Open in PluralEyes…’ if you want to send it out to the standalone app to work on it some more. There’s a handy tutorial over on the Red Giant site that talks you through how it works, but it’s as simple as selecting a sequence and hitting ‘Synchronise’ and then PluralEyes 4 will create a duplicate sequence of your newly synched media. ![]() The native sync abilities within Premiere have never seemed to work very well for me, or bring up a progress bar that’s too slow to bother with. Only a few companies have taken advantage of this ability so far, ( PDF Viewer is one) and it’s great to see it happening more often. One of the other features I’m most excited about is the direct integration of PluralEyes synchronisation functionality into Premiere Pro via an extension panel. Try it for yourself for 14 days or 20 offloads for free. The manual is also very well written and easy to follow. If you want to know more about Silverstack it’s worth checking out the official Getting Started page here, which features lots of links to further info including a list of supported camera file formats, wherein unsurprisingly all the usual suspects are covered. But if I were a working DIT, I would snap up Silverstack XT in a heartbeat. Of course if price is a consideration then it’s worth noting that something like ShotPut Pro is 1/4 of the price, especially when combined with using DaVinci Resolve as a free dailies too. If you only need the app for a two week shoot for example you can snap up XT for only $69. ![]() An annual subscription to Silverstack is $399 and for the more full functional Silverstack XT, $599. There are two versions of Silverstack available at two different prices, operating on an annual, monthly or 14 day subscription model. The ability to see offload statistics, tag things in FCPX style smart folders, export metadata reports with thumbnails, handle CDL’s and LUTs, transcode (and add framelines at the same time) and many, many other things, make this the DIT app of choice, especially for anyone looking to do some heavy lifting on set. If I was doing more editorial prep work on-set, then I would absolutely upgrade to Silverstack XT for the far greater functionality across the board than you get in other apps. In the colour grading side of the app it’s nice to have the choice to switch back and forth between colour wheels and sliders with a click whilst working, although the wheels had a nice fine grain feel to them, whilst the slider adjustments felt a little heavy handed to me. In many ways the extra details adds a level of clarity, even to simple tasks like the offload process, because you have to think about what you’re doing, with a tiny bit more thoroughness, which helps you avoid making sloppy mistakes. ![]() If you’re used to a simple looking offload app interface, like ShotPut Pro or EditReady’s, then Silverstack’s more detailed configuration can appear a little daunting at first, but it’s actually extremely well thought out, with everything you need to see for the specific task at hand, available immediately. ![]()
0 Comments
![]() Please note this is EXPERIMENTAL, do not expect it to work like on Intel/AMD. I built a GNS3 VM for ARM which can run on Apple silicon M1. I remember of some Solaris Sparc images back in the days but nothing about ARM. It is not possible to run IOU because IOU images are compiled for i386 or x86_64. However, Dynamips has been compiled without JIT (Just In Time) support which may slow things down or not be as optimized.Ĭonclusion: supported but may be slower or unstable IOU I was able to manually create a template for IOSv-L2 and I had to force to not using KVM by adding -machine accel=tcg otherwise the server would complain that KVM is not available.Ĭonclusion: supported but likely to be really slow Dynamipsĭynamips seems to work okay. So I don't expect we will see nested virtualization until Apple or VMware does something. However, as expected, nested virtualization isn't possible even after trying to enable it on the Qemu command line (virtualization=on). However, Apple's virtualization solution doesn't currently support those.Īlso, I was successful to run the GNS3 VM using a patched QEMU leveraging amework (hvf acceleration): see or Kvm : Hyp mode initialized successfullyĪs you can see GNS3 VM doesn't start with Hypervisor mode or EL2:Īlso, I read the following nested virtualization including the ARMv8.4 improvements are present on Apple M1. My understanding is that to use KVM, the firmware must start Linux in hypervisor (EL2 / HYP) mode and the kernel should print something like this: Qemu is the big issue because KVM hardware acceleration is not supported. Ĭonclusion it is only possible to Docker containers made for arm64/v8 Qemu It is currently only possible to run images / containers made for other architectures on a x86_64 host, see and. Standard_init_linux.go:228: exec user process caused: exec format error WARNING: The requested image's platform (linux/amd64) does not match the detected host platform (linux/arm64/v8) and no specific platform was requested Status: Downloaded newer image for amd64/ubuntu:latest ![]() This is what happens if you want to run Ubuntu image made for amd64 docker run -rm -t amd64/ubuntu uname -m We aim to have our containers built for multiple architectures at a later stage. You can quickly check on Docker Hub what architectures are supported, for instance Ĭompare this with a container we distribute,, which only supports amd64. ![]() However, any image or container you want to run must be built for the arm64v8 architecture, most images like Ubuntu, Alpine etc. Note that this will not be needed with GNS3 version >= 3.0, the server will automatically use the host busybox: GNS3/gns3-server#1908 Sudo cp /usr/bin/busybox /usr/local/lib/python3.8/dist-packages/gns3server/compute/docker/resources/bin/busybox The workaround is to SSH to the GNS3 VM and type this command: Trying to run a container out of the box will result in an exec format error because the busybox binary that is distributed part of the GNS3 server package is compiled for the x86_64 architecture, not ARM. Launch GNS3 and use the VM as a remote server Go to the first adapter settings and make sure it is configured to be private Go back to the VM settings and add another device Go to the VM settings and add an additional device The GNS3 VM is based on Ubuntu 20.04 LTS for ARM64 architecture (aarch64). It is not possible to import an OVA at the moment, see #3257 (comment) Installation on VMware Fusion Create a custom virtual machine See below for limitations, workarounds and other issues. VMware Fusion for M1 itself is just a preview. ![]() ![]() ![]() ![]() There is some OK voice acting in the game but it only makes up about 20% of the dialogue, with the rest just text. All the NPC’s in the game look stiff and talk without their mouths moving, and already you can feel the immersive experience required for RPG’s fading away. That is a good job because it’s far from it. Let’s start with the graphics considering this was a mobile port, you cannot expect a masterpiece. So it has taken 7-8 years to get ported to the Xbox and considering the game was a hit on mobile devices it should hold some joy for RPG fans, right? It then surprised me more to realise Ravensword: Shadowlands was originally released for mobile devices in 2013. I had not heard of this game and was surprised to realise it was a mobile game back from 2010. Now upon research, I discovered this is a sequel to Ravensword: The Fallen King. But it has long since been missing, so you need to set out on your path to finding it as it will be the only way to save the kingdom of Tyreas. So you go on an adventure to discover why you might have survived and the story starts to develop you find – as you might expect – that you are part of the bloodline that can wield the titular Ravensword. ![]() Both the army of Tyreas and the dark Elf army were wiped out and no one knows why or how. You play the part of a soldier downed in a battle against the dark elves, yet despite this you managed to survive. The world does feel lonely as it is very scarcely populated, but the beings and animals it is populated with is a little mind-boggling. The world in this game does feel very grand and although the graphics will not blow you away they are still decent. Ravensword: Shadowlands is an adventure RPG into a vast open world. Developed by Crescent Moon Games and published by Ratalaika Games S.L. ![]() ![]() ![]() $(MSBuildExtensionsPath)\Microsoft\VisualStudio\v$(VisualStudioVersion)\SSDT\.SqlTasks. Proven ability to plan, co-ordinate and implement Full Life Cycle of Oracle EBS Implementation. sqlproj supposedly replaced it with Publish, how come it's still there and what is it still used for? Over 13 years of working experience in Oracle Application E - Business Suite Versions R 12.1.3/12.2.4/11 i and Oracle Cloud Financials in lead roles with excellent technical project, team ![]() ![]() You've got that athletic feeling, you’re ready for action with your hands in fists and just this kind of I'm ready feeling. They would grab stills of runners when they're about to run.” That was really cool, looking at those. Look at the photos of athletes because that was what comic book artists were using for their illustrations. He's like, “You've got to look at Olympic athletes and their physicality. I grew up watching the ‘ Batman: The Animated Series’ and ‘ Justice League.’ I wanted to look like a superhero and I wanted to make sure I was doing it right. Why is this feeling so complicated? I know it's not, but I grew up looking at comic books. I was talking to someone in our costume department and I was like, this is my first day on set, and I don't know how to stand. So, definitely getting to explore playing a superhero and then nerd out and have the kind of thoughts of, how do I pose my body when I'm flying or standing, and how is this different from when I'm human? That was really fun. I'm able to land from a crazy high height and do a fun superhero landing. I'm able to flip upside down while flying and do all sorts of fun stuff, thanks to the harness. It feels like the harness is a superpower in a way because I put it on and suddenly I'm able to fly. I really love being in the stunt harness. I guess it was a level up for the human form of our characters too because we got to ride unicorns this time around and have a lot of action going on even in our human forms. MF: What was it like for you to finally wear the costume and perform some of your own stunts in the action sequences? Related Article: Zachary Levi Talks 'Shazam! Fury of the Gods' and Playing a Superhero Cotrona as Super Hero Pedro in New Line Cinema’s action adventure 'Shazam! Fury of the Gods,' a Warner Bros. (L to R) Meagan Good as Super Hero Darla, Grace Caroline Currey as Super Hero Mary and D.J. But yeah, the explanation was just that I'm the oldest and I'm an adult, and there you go. ![]() Let's have you be responsible for her human form, and her superhero form.” That was the best for me as an actor because I got to really plot out who Mary is through and through and be responsible for that continuity. I had a wonderful time getting to play Mary's dramatic moments and then getting to play the entirety of her in her superhero form. I think also technically speaking, when you have an adult actress playing the human form, it does visually get a little tricky when you have two adults playing the same role. But I will say, if you were going to have any of the kids do it, she’s the only one that makes sense because she’s the oldest, she is an adult. So it was actually pretty comic book accurate to have me doing both. GCC: I mean, technically speaking, and I think comic book wise, Mary didn't visually change a whole ton when she was Mary Marvel in her comic book run. MF: Was it ever explained to you why the decision was made for you to be the only actor playing both your character and their superhero counterpart? (L to R) Ross Butler as Super Hero Eugene and Grace Caroline Currey as Super Hero Mary in New Line Cinema’s action adventure 'Shazam! Fury of the Gods,' a Warner Bros. That was another moment of, is this real? I think it didn't feel real until I was in fittings and actually putting a costume on and looking at myself in the mirror and going, I don't know what's happening, but it's happening and I'm here. But then also getting to be told, not only was I coming back for the sequel, but that I was going to get to be in the suit as well. Obviously, we have a massive cast and getting everyone's schedules together was wild. Grace Caroline Currey: I mean, quite a few years had passed and every year that passed I feel like our whole cast would say, “Has anyone heard anything? Are we going to get a sequel? When is it happening?” So finally I got the call that we were going to get a sequel, it was happening, and it was a very long awaited phone call. Moviefone: To begin with, when did you learn that you would not only be returning for the ‘Shazam!’ sequel to play Mary Bromfield but that you would also be playing the character in her superhero form? You can read the full interview below or click on the video player above to watch our interview with Grace Caroline Currey about ‘Shazam! Fury of the Gods.’ Grace Caroline Currey attends the World Premiere of 'Shazam! Fury of the Gods' in Westwood, CA. ![]() ![]() ![]() Most likely, however, this is just a myth developed in the west. Legend says, however, that the first predecessor of the game was invented by Confucius himself in around 500 BCE. The origin of Mahjong is quite mysterious, but we can be sure that Mahjong in its current form did not exist until as late as mid 19th century CE.
![]() So in a situation in which battle between PH and pka is the pt is less and if the pka in more than that means that more poston out side it means molecule going to bind with proton that in they will going, proteinated jej poeton Badded to the pepride (PH/pkal) If the pH h more and if the pka is less than that means that more of ions in the envorment it moars molecule to de protenated. This project is in no way not affiliated, sponsored, or otherwise endorsedīy the original Peptides authors.The structure of peptide is given by plaz 10.5 Ho O H H ha Pk 9.6 pka=2.0 HOT Pe: 10.5 are they going Pka = 6.0 peptide going to take a proton from the solution or going to donate a proton to the solution which can i figur out with the value from pka. Released under the GNU General Public License v1.0. The terms of the GNU General Public License v2.0. The original R Peptides package was written by Daniel Osorio, This library is provided under the GNU General Public License v3.0. In a simple, easily reproducible situation. Information as you can about the issue, and try to recreate the same bug If you are filing in on a bug, please include as much 0.299333 0.465333 - 0.976667 0.023333 □ Feedback ⚠️ Issue Trackerįound a bug ? Have an enhancement request ? Head over to the GitHub issue DataFrame () > df BLOSUM1 BLOSUM2 BLOSUM3 BLOSUM4. This makes it very easy to create a pandas.DataFrame withĭescriptors for several protein sequences: > seqs = > df = pandas. Use the scriptors method to get a dictionary with every availableĭescriptor. Will return a dedicated named tuple: > peptide. Methods that return more than one scalar value (for instance, Peptide.blosum_indices) Then use the appropriate methods to compute the descriptors you want: > peptide. Peptide ( "MLKKRFLGALAVATLLTLSFGTPVMAQSGSAVFTNEGVTPFAISYPGGGT" ) Start by creating a Peptide object from a protein sequence: > import peptides > peptide = peptides. Which hosts universal wheels that can be installed with pip: $ pip install peptidesĬan be found in the online documentation, Install the peptides package directly from PyPi (like numpy.sum or numpy.take) will be used, otherwise a fallbackįrom the standard library is available. If numpy can be imported, relevant functions Taken in a lookup table, so computing them can be done in a vectorized manner. Most of the descriptors for a protein sequence are simple averages of values Reach out and open a feature request on the issue tracker If this library is missing a useful statistic or descriptor, feel free to Biological properties: structural class prediction.Physicochemical properties: aliphatic index, instability index, theoretical net charge, isoelectric point, molecular weight (with isotope labelling support).Sequence profiles: hydrophobicity, hydrophobic moment, membrane position. ![]() ![]() ![]() ![]() QSAR descriptors: BLOSUM indices, Cruciani properties, FASGAI vectors, Kidera factors, MS-WHIM scores, PCP descriptors, ProtFP descriptors, Sneath vectors, ST-scales, T-scales, VHSE-scales, Z-scales.Peptide statistics: amino acid counts and frequencies.This library has no external dependency and is available for all modern PythonĪ non-exhaustive list of available features: It started as a port of Peptides, the R package written byĮxPASy Protein Identification and Analysis Tools, and Rcpi. Peptides.py is a pure-Python package to compute common descriptors for Physicochemical properties, indices and descriptors for amino-acid sequences. ![]() ![]() ![]() All you need is a microphone, and your recording will automatically result to the standard MP3 format. No matter what sound you want to capture, MP3 Toolkit is there to help you. MP3 Toolkit allows users to cut MP3 files with ease, so that the audio editing process is expedited. Some portions are not important, so these have to be removed to either save some memory or to be utilized for another output. Audio files are often cut for purposes like ring-tone making and the like. MP3 Toolkit prides itself of the following key features: Cuts MP3 files. Good news! MP3 Toolkit, an all-in-one software, is the latest creation that will surely make life easier for newbies and junkies alike. Artists have to master the craft of handling them in order to make music. One needs to be knowledgeable for creating audio-visual presentations. ![]() MP3 Toolkit: Utility and Security Combinedĭealing with audio files is a norm in a technologically advanced world. If your sound card supports analog, you can record the stream audio also. It allows you to record any sound from your micphone directly to standard MP3 format, and no length limitation. It also has the ability to cut a part of music from a video file, or a movie. It can cut a specific time audio piece from a song. Using MP3 Cutter to make ringtones is a good choice. Got some cool audio parts to combine? MP3 Merger can merge & combine your several FLAC, MP3, OGG and WAV audio files to a complete single audio file. Also, the editor will allow you to edit album photos and lyrics. ![]() It supports all ID3v1 and ID3v2 versions. With this program you will be able to edit MP3 tag information in batch mode. CD to MP3 Ripper will help you to rip the audio from CD to MP3, WMA, APE or WAV for common players. The audio CD contains audio tracks (.cda) files which cannot be copied to use directly. It can also extract the audio stream from popular video formats like MP4, FLV, AVI etc. You can convert audio file formats between standard MP3 audio and WMA, WAV, OGG, AAC and more. ![]() ![]() ![]() 51 Multilingual Pinnacle Studio Ultimate 12 1 dvd & 1 cd Rosetta Stone 3.2.11 Application Rosetta Stone 3 Spanish-Spain 1, 2, 3 Language files only 3 cds Rosetta Stone 3 Russian 1, 2, 3 Language files only 3 cds Rosetta Stone 3 French 1, 2, 3 Language files only 3 cds Rosetta Stone 3 Italian 1, 2, 3 Language files only 3 cds Big Fish Audio G-Suite Multiformat 1 dvd Big Fish Audio - Rotation WAV REX AiFF Apple Loops 1 dvd Avid XPress Pro 4.5.1 1 cd Adobe Creative Suite 5 Master Collection ESD 1 dvd Noise Ninja Pro Plugin Bundle for Mac Nik Software Sharpener Pro 3.0 For Photoshop for Mac Camera Bits Photo Mechanic 4.5.3 Best Service Galaxy II VSTi Dxi RTAS AU for PC 5 dvds Kelby Training Lightroom 3 In Depth Vol.1 Importing and Organizing Your Photos 1 cd Kelby Training Lightroom 3 In Depth Vol.2 Developing and Editing Your Photos 1 cd Kelby Training Lightroom 3 In Depth Vol.3 Printing and Showing Off Your Photos 1 cd Native Instruments Kontakt 4.0.2 VSTi RTAS 1 cd ToneHammer Old Busted Granny Piano KONTAKT 1 dvd Visual Studio ActiveX Components Pack 2 FileMaker Pro Advanced 10.0.1 Multilanguage 1 cd Autodesk AutoCAD LT 2010 English 1 dvd 1 Form Proposal-Invoice v1.3 CorelDRAW Graphics Suite X5 15.0.0.486 Adobe Photoshop CS5 Extended 12.0 1 dvd Adobe Font Folio 11 Open Type 1 cd 3D Studio MAX 9.0 1 dvd Nik Software Complete Collection For Photoshop and Aperture for Mac Adobe Acrobat 9.0 Pro Extended 1 dvd High-Logic FontCreator Professional Edition 5.6 Adobe Photoshop Elements 2 1 cd Garritan Personal Ochestra VSTi form Mac and PC 4 cds Ashlar-Vellum Graphite 8.4.3 SP1 for Mac EON VUE 8.5 xSTREAM 1 dvd Formz Radiozity 5.0 1 cd GibbsCAM 2009 9.3.6 1 cd Mastercam 9.1 with SP2 2 cd Whole Tomato Visual Assist X for Visual Studio 2010. 16989 1 dvd IMonitorPC Pro 3.4.0 Nero Multimedia Suite 10 Multilanguage 1 dvd Raxco PerfectDisk 10.0.0.119 Server Topaz Adjust 4.0.3 Topaz DeNoise 4.1.0 Noiseware 4.1.1.0 Professional Imagenomic Portraiture 2.0 - Photoshop Retouching Plugin Nik Software Silver Efex Pro 1.0 CyberLink PowerDVD Ultra 3D. aus Bremen - Versandhandel für hochwertigen Tee Adobe InDesign CS5 Premium 7.0 1 cd Autodesk Autocad Architecture 2010 German 2 dvds Aperture 3.0 Full for Mac 1 dvd Adobe Acrobat 9 Pro for Mac 1 cd Adobe Photoshop CS5 Extended 12.0 for Mac 1 dvd Nikon Camera Control Pro 2.20 Nikon Capture NX 2.1.1 for Mac COMSOL Multiphysics 4.0 Multiplatform 1 dvd - Final Cut Pro 6 Essential Effects with Larry Jordan 1 dvd The Sims Original for Mac Cyberlink PowerDVD Ultra Autocad 2004 Native Instruments Massive VSTi DXi RTAS 1.1.2 Delphi 2009 RTM. "6.7 "Intel Rapid,Start,Driver.,"bittorrent.OneDrive, work, DepositFiles Amadis.Zune ,Video,Converter.The Betty Darling Tea Company Ltd. extension.,"720p, 4.6 ,download "Pixel.Force: Halo.3.0" usenet"crack. magnet,links ZippyShare, year.2013" Goutte d'Or" limetorrents. ![]() "ASUS B150M-V.PLUS" Intel ,Graphics" Driver. Last software PulpMotion Advanced 3.6.1 Build 5110 10.12.2 RapidShare extension macĭownload PulpMotion Advanced 3.6.1 Build 5110 indian 4Shared extension app 10.10.4 Official PulpMotion Advanced 3.6.1 Build 5110 MacOS open torrent frenchįree drive PulpMotion Advanced 3.6.1 Build 5110 format phone iptorrents spanish Last format app PulpMotion Advanced 3.6.1 Build 5110 file hosting RapidShare Boxĭownload format mac PulpMotion Advanced 3.6.1 Build 5110 dutch OS X El Capitan 10.10.5 Get 1337x PulpMotion Advanced 3.6.1 Build 5110 10.12.4 torrent index 10.11 El Capitan k2sįree PulpMotion Advanced 3.6.1 Build 5110 extension zip format ios Repack Box PulpMotion Advanced 3.6.1 Build 5110 Transmission get 1337x Work PulpMotion Advanced 3.6.1 Build 5110 filelist cloud ![]() Last PulpMotion Advanced 3.6.1 Build 5110 torrent format ios 10.12 Sierraĭownload PulpMotion Advanced 3.6.1 Build 5110 drive 10.10.1 archive Repack PulpMotion Advanced 3.6.1 Build 5110 portuguese format macįree format pkg PulpMotion Advanced 3.6.1 Build 5110 without ad torrent get rar buggyĪpp usenet PulpMotion Advanced 3.6.1 Build 5110 Transmission extension ipad 1337x Stable PulpMotion Advanced 3.6.1 Build 5110 magnet links zipshare format pkgĭownload PulpMotion Advanced 3.6.1 Build 5110 download extension mobile Last official PulpMotion Advanced 3.6.1 Build 5110 archive stable bittorrent 10.11.5 extension iosįree spanish PulpMotion Advanced 3.6.1 Build 5110 format ios open torrent Last 10.11.3 PulpMotion Advanced 3.6.1 Build 5110 full ❒ ❒ ❒ PulpMotion Advanced 3.6.1 Build 5110Īpp PulpMotion Advanced 3.6.1 Build 5110 format zip ![]() ![]() ![]() Read Review View Swatches View Dupes Where to Buy 02. Groundwork is a neutral mid-toned taupe-ish brown with a matte finish, and I love it for everyday looks. On inspecting it very closely I could make. MAC Groundwork Paint Pot(21) Oh, MAC Groundwork How I heart thee. To the product you're purchasing, or the brand or retailer's website for the most up-to-date ingredient list. A- MAC Groundwork Pro Longwear Paint Pot (23.00 for 0.17 oz.) is a light, taupe-brown with subtle, warm undertones and a mostly matte finish. If I had to describe it in laymans terms I would describe it as a peach tone light brown shade with a sheen to it. Please always check product packaging, if it exists, for the ingredient list applicable I don't need to apply a lot and it would take a lottt of uses before it was all gone.Isododecane, Calcium Sodium Borosilicate, Dimethicone, Polyethylene, Hydrogenated Polyisobutene, Quaternium-90 Bentonite, Dimethicone Silylate, Silica, Octyldodecanol, Tocopheryl Acetate, Lecithin, Trihydroxystearin, Copernicia Cerifera (Carnauba) WaxCera CarnaubaCire De Carnauba, Propylene Carbonate, Triethoxycaprylylsilane, Tin Oxide, Calcium Aluminum Borosilicate, Pentaerythrityl Tetra-Di-T-Butyl Hydroxyhydrocinnamate, ĭisclaimer: Ingredient lists are as available by the brand (or retailer)Īt the time of publishing. mac paint pot vintage Product Description A highly pigmented eye colour that goes on creamy but dries to an intense, vibrant finish. It appeared grayish when applied as full coverage and warmer, more red-toned when applied as a sheerer wash of product. This eyeshadow has a creamy and velvety texture that. The pot is a good size and the product lasts a long time. MAC Groundwork Pro Longwear Paint Pot (23.00 for 0.17 oz.) is a light, taupe-brown with subtle, warm undertones and a mostly matte finish. What is it The Pro Longwear Paint Pot from MAC is a highly pigmented, long-wearing eye shadow that goes on creamy and dries to an intense, vibrant finish. 29,52 MAC Pro Longwear Paint Pot - Layin Low is a waterproof eye shadow that lasts up to 24 hours. Its a brown/grey shade that acts as a great base or the perfect every day. It makes my trickier eyeshadows (colourful, bold shades, shades with less pigment etc) a lot easier to work with and look a lot better than if I was using regular concealer or a more thinner base. Finally, for more of a matte-natural finish, try MAC Paint Pot in Groundwork. When eyeshadow is applied straight onto this base, I find it makes them look more pigmented and easier to blend. It's my go to when I go out or want my makeup to look good for a long time. This makes my eyeshadow last all day without creasing or fading or smudging. ![]() I just set it with a bit of powder and I'm good to go! I like using it as well when I'm not wearing any eyeshadow for that reason. It has good coverage and covers any veins or redness that I have on my eyes. When applied at more opaque coverage, it looked grayer, and then when diffused, the brown tone came through more visibly. Pro Longwear Paint Pot Eye Shadow by MAC is a product that offers maximum eye coverage in a seemingly. The innovative second skin-like formula blends smoothly over lids and creates seamless, buildable coverage without looking heavy or cakey. It goes on creamy and dries to an intense, vibrant finish that lasts for 24 hours. (I'll usually go over it with a sponge, quickly, to make sure it's all blended). MAC Tailor Grey Pro Longwear Paint Pot (23.00 for 0.17 oz.) is a medium, grayish-taupe with subtle, warm undertones and a cooler overtone paired with a matte finish. MAC Cosmetics Pro Longwear Paint Pot-Groundwork. MAC Pro Longwear Paint Pot is a highly pigmented, long-wearing, blendable eye primer and/or cream eye shadow. I use a fluffy concealer brush and it doesn't take me long to buff this out. I don't need to apply a lot and it's super easy to blend out. A highly pigmented, long-wearing eye shadow with primer benefits that goes on creamy and dries to an intense, vibrant finish. Soft ochre has warmer undertones and painterly has cooler undertones. I believe they have two shades for eyeshadow bases - painterly and soft ochre. I do think there are dupes for this as an eyeshadow primer for a more affordable price, but this one works the best out of the ones I've tried. I use it as an eyeshadow base and I highly recommend it. ![]() |